PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 223aa    MW: 26060.3 Da    PI: 9.8367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2460genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-15450147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-.HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt.lkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia++++ gR+ +k+c++rw++ 
      Gh_A12G2460  4 RGHWRPAEDEKLRELVERHGPHNWNAIAQKLQ-GRSaGKSCRLRWFNQ 50
                     899*****************************.999459******996 PP

2Myb_DNA-binding60.73.1e-1957100146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_A12G2460  57 RSPFTEEEEERLLSAHRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 100
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.869151IPR017930Myb domain
SMARTSM007172.0E-11353IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-28498IPR009057Homeodomain-like
PfamPF002493.0E-15450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-25558IPR009057Homeodomain-like
CDDcd001673.19E-12749No hitNo description
PROSITE profilePS5129426.2752106IPR017930Myb domain
SMARTSM007172.8E-1656104IPR001005SANT/Myb domain
PfamPF002492.9E-165799IPR001005SANT/Myb domain
CDDcd001671.52E-125999No hitNo description
Gene3DG3DSA:1.10.10.609.0E-2259105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVE RHGPHNWNAI AQKLQGRSAG KSCRLRWFNQ LDPRINRSPF  60
TEEEEERLLS AHRIHGNRWA VIARLFPGRT DNAVKNHWHV IMARRCRQRS SLYAKTSHTT  120
PSKPLHHSQM GAGHGFLPLL HKYKQGFPHN TCSPLNPNHC VTTTQDKKEA IEFYDFLQVN  180
TDSNNKSEVT ENSRRDDEEV NQQEAMPLME HHTKARPSFF NFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-3241067108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440359.11e-164PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0D2RPJ81e-167A0A0D2RPJ8_G
STRINGVIT_17s0000g01890.t015e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.18e-79myb domain protein 52